Icon representing a puzzle

2650: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
August 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,726
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 10,791
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,714
  1. Avatar for foizshiqer 71. foizshiqer Lv 1 1 pt. 10,688
  2. Avatar for nancy_naniewoo 72. nancy_naniewoo Lv 1 1 pt. 10,580
  3. Avatar for Swapper242 73. Swapper242 Lv 1 1 pt. 9,038
  4. Avatar for mcpal 74. mcpal Lv 1 1 pt. 8,949
  5. Avatar for apetrides 75. apetrides Lv 1 1 pt. 8,949

Comments