Icon representing a puzzle

2650: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
August 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,429
  2. Avatar for Go Science 2. Go Science 65 pts. 12,378
  3. Avatar for Contenders 3. Contenders 41 pts. 12,197
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 12,154
  5. Avatar for Australia 5. Australia 14 pts. 12,135
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 11,940
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 11,939
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 11,889
  9. Avatar for Team China 9. Team China 1 pt. 11,871
  10. Avatar for VeFold 10. VeFold 1 pt. 11,846
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,427
  2. Avatar for Galaxie 2. Galaxie Lv 1 33 pts. 12,423
  3. Avatar for alcor29 3. alcor29 Lv 1 8 pts. 12,380
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 2 pts. 12,375
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 1 pt. 12,372
  6. Avatar for Anfinsen_slept_here 6. Anfinsen_slept_here Lv 1 1 pt. 11,879

Comments