Icon representing a puzzle

2653: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
August 27, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 10,499
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 1 pt. 9,577
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,605
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 11,553
  3. Avatar for grogar7 3. grogar7 Lv 1 88 pts. 11,482
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 82 pts. 11,375
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 77 pts. 11,287
  6. Avatar for akaaka 6. akaaka Lv 1 71 pts. 11,270
  7. Avatar for gmn 7. gmn Lv 1 66 pts. 11,218
  8. Avatar for nicobul 8. nicobul Lv 1 62 pts. 11,211
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 57 pts. 11,169
  10. Avatar for Galaxie 10. Galaxie Lv 1 53 pts. 11,138

Comments