Icon representing a puzzle

2653: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since 6 months ago

Novice Overall Prediction

Summary


Created
August 27, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,606
  2. Avatar for Go Science 2. Go Science 63 pts. 11,554
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 11,287
  4. Avatar for VeFold 4. VeFold 21 pts. 11,119
  5. Avatar for Australia 5. Australia 11 pts. 11,085
  6. Avatar for Contenders 6. Contenders 5 pts. 11,048
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 10,921
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 10,870
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,755
  10. Avatar for Team China 10. Team China 1 pt. 10,740

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,606
  2. Avatar for LociOiling 2. LociOiling Lv 1 41 pts. 11,603
  3. Avatar for alcor29 3. alcor29 Lv 1 14 pts. 11,587
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 4 pts. 11,554
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 1 pt. 11,521
  6. Avatar for Apothecary1815 6. Apothecary1815 Lv 1 1 pt. 11,101
  7. Avatar for SemperRabbit 7. SemperRabbit Lv 1 1 pt. 10,990

Comments