Icon representing a puzzle

2653: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since 7 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
August 27, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,606
  2. Avatar for Go Science 2. Go Science 63 pts. 11,554
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 11,287
  4. Avatar for VeFold 4. VeFold 21 pts. 11,119
  5. Avatar for Australia 5. Australia 11 pts. 11,085
  6. Avatar for Contenders 6. Contenders 5 pts. 11,048
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 10,921
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 10,870
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,755
  10. Avatar for Team China 10. Team China 1 pt. 10,740

  1. Avatar for gutest01 61. gutest01 Lv 1 1 pt. 9,577
  2. Avatar for fikret 62. fikret Lv 1 1 pt. 9,549
  3. Avatar for Swapper242 63. Swapper242 Lv 1 1 pt. 9,525
  4. Avatar for rinze 64. rinze Lv 1 1 pt. 9,489
  5. Avatar for j_oda 65. j_oda Lv 1 1 pt. 9,468
  6. Avatar for Ainswoth 66. Ainswoth Lv 1 1 pt. 9,462
  7. Avatar for Kanta1225 67. Kanta1225 Lv 1 1 pt. 9,379
  8. Avatar for Assembly 68. Assembly Lv 1 1 pt. 9,374
  9. Avatar for Fasodankfds 69. Fasodankfds Lv 1 1 pt. 9,361
  10. Avatar for luMar123 70. luMar123 Lv 1 1 pt. 9,318

Comments