Icon representing a puzzle

2656: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 03, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,111
  2. Avatar for Mahmut Oyunda 12. Mahmut Oyunda 1 pt. 10,706
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,433
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 10,211
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 10,023
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 9,639
  7. Avatar for Firesign 17. Firesign 1 pt. 9,086
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,730
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 11,686
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 88 pts. 11,551
  4. Avatar for grogar7 4. grogar7 Lv 1 82 pts. 11,533
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 77 pts. 11,499
  6. Avatar for nicobul 6. nicobul Lv 1 72 pts. 11,498
  7. Avatar for ichwilldiesennamen 7. ichwilldiesennamen Lv 1 67 pts. 11,422
  8. Avatar for georg137 8. georg137 Lv 1 62 pts. 11,390
  9. Avatar for SemperRabbit 9. SemperRabbit Lv 1 58 pts. 11,376
  10. Avatar for gmn 10. gmn Lv 1 54 pts. 11,371

Comments