Icon representing a puzzle

2656: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
September 03, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,733
  2. Avatar for Go Science 2. Go Science 73 pts. 11,686
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,498
  4. Avatar for Contenders 4. Contenders 36 pts. 11,390
  5. Avatar for Australia 5. Australia 24 pts. 11,366
  6. Avatar for VeFold 6. VeFold 16 pts. 11,326
  7. Avatar for Team China 7. Team China 10 pts. 11,311
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 11,254
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 11,253
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 11,138

  1. Avatar for AlkiP0Ps 11. AlkiP0Ps Lv 1 50 pts. 11,366
  2. Avatar for Galaxie 12. Galaxie Lv 1 46 pts. 11,365
  3. Avatar for meatexplosion 13. meatexplosion Lv 1 43 pts. 11,344
  4. Avatar for bravosk8erboy 14. bravosk8erboy Lv 1 40 pts. 11,343
  5. Avatar for Dr. Goochie 15. Dr. Goochie Lv 1 37 pts. 11,339
  6. Avatar for BarrySampson 16. BarrySampson Lv 1 34 pts. 11,326
  7. Avatar for Zhang Ruichong 17. Zhang Ruichong Lv 1 31 pts. 11,311
  8. Avatar for akaaka 18. akaaka Lv 1 29 pts. 11,310
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 26 pts. 11,302
  10. Avatar for hookedwarm 20. hookedwarm Lv 1 24 pts. 11,278

Comments