Icon representing a puzzle

2656: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
September 03, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,733
  2. Avatar for Go Science 2. Go Science 73 pts. 11,686
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,498
  4. Avatar for Contenders 4. Contenders 36 pts. 11,390
  5. Avatar for Australia 5. Australia 24 pts. 11,366
  6. Avatar for VeFold 6. VeFold 16 pts. 11,326
  7. Avatar for Team China 7. Team China 10 pts. 11,311
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 11,254
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 11,253
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 11,138

  1. Avatar for piotrhalama 71. piotrhalama Lv 1 1 pt. 9,669
  2. Avatar for eweber 72. eweber Lv 1 1 pt. 9,639
  3. Avatar for gumster010 73. gumster010 Lv 1 1 pt. 9,322
  4. Avatar for aphil126 74. aphil126 Lv 1 1 pt. 9,086
  5. Avatar for lukesarcher03 75. lukesarcher03 Lv 1 1 pt. 9,086
  6. Avatar for NickDanger 76. NickDanger Lv 1 1 pt. 9,086
  7. Avatar for jdubz 77. jdubz Lv 1 1 pt. 9,086

Comments