Icon representing a puzzle

2662: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,800
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,667
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,441
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,262
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,690
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 12,096
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 94 pts. 12,092
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 11,952
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 81 pts. 11,679
  5. Avatar for grogar7 5. grogar7 Lv 1 75 pts. 11,598
  6. Avatar for akaaka 6. akaaka Lv 1 70 pts. 11,587
  7. Avatar for Xendrais 7. Xendrais Lv 1 65 pts. 11,554
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 60 pts. 11,540
  9. Avatar for AlkiP0Ps 9. AlkiP0Ps Lv 1 56 pts. 11,533
  10. Avatar for Dr. Goochie 10. Dr. Goochie Lv 1 51 pts. 11,506

Comments