Icon representing a puzzle

2662: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since 9 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Go Science 100 pts. 12,104
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,952
  3. Avatar for Australia 3. Australia 47 pts. 11,533
  4. Avatar for Contenders 4. Contenders 30 pts. 11,499
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 11,446
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,333
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 11,214
  8. Avatar for VeFold 8. VeFold 4 pts. 11,147
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,058
  10. Avatar for Team China 10. Team China 1 pt. 10,850

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 12,104
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 41 pts. 12,093
  3. Avatar for LociOiling 3. LociOiling Lv 1 14 pts. 11,952
  4. Avatar for Galaxie 4. Galaxie Lv 1 4 pts. 11,949
  5. Avatar for alcor29 5. alcor29 Lv 1 1 pt. 11,929
  6. Avatar for Apothecary1815 6. Apothecary1815 Lv 1 1 pt. 11,330
  7. Avatar for nicobul 7. nicobul Lv 1 1 pt. 11,319

Comments