Icon representing a puzzle

2662: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since 7 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Go Science 100 pts. 12,104
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,952
  3. Avatar for Australia 3. Australia 47 pts. 11,533
  4. Avatar for Contenders 4. Contenders 30 pts. 11,499
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 11,446
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,333
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 11,214
  8. Avatar for VeFold 8. VeFold 4 pts. 11,147
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,058
  10. Avatar for Team China 10. Team China 1 pt. 10,850

  1. Avatar for ProfVince 41. ProfVince Lv 1 2 pts. 10,555
  2. Avatar for jamiexq 42. jamiexq Lv 1 2 pts. 10,533
  3. Avatar for pfirth 43. pfirth Lv 1 2 pts. 10,445
  4. Avatar for ShadowTactics 44. ShadowTactics Lv 1 1 pt. 10,441
  5. Avatar for zbp 45. zbp Lv 1 1 pt. 10,438
  6. Avatar for Vinara 46. Vinara Lv 1 1 pt. 10,410
  7. Avatar for Apothecary1815 47. Apothecary1815 Lv 1 1 pt. 10,379
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 1 pt. 10,313
  9. Avatar for Larini 49. Larini Lv 1 1 pt. 10,300
  10. Avatar for fikret 50. fikret Lv 1 1 pt. 10,262

Comments