Icon representing a puzzle

2662: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since 7 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Go Science 100 pts. 12,104
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,952
  3. Avatar for Australia 3. Australia 47 pts. 11,533
  4. Avatar for Contenders 4. Contenders 30 pts. 11,499
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 11,446
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,333
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 11,214
  8. Avatar for VeFold 8. VeFold 4 pts. 11,147
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,058
  10. Avatar for Team China 10. Team China 1 pt. 10,850

  1. Avatar for antibot215 61. antibot215 Lv 1 1 pt. 9,843
  2. Avatar for efull 62. efull Lv 1 1 pt. 9,834
  3. Avatar for Jeuxdit<3 63. Jeuxdit<3 Lv 1 1 pt. 9,739
  4. Avatar for EvalynJR 64. EvalynJR Lv 1 1 pt. 9,716
  5. Avatar for Tkzw-shieu 65. Tkzw-shieu Lv 1 1 pt. 9,702
  6. Avatar for nabwio 66. nabwio Lv 1 1 pt. 9,698
  7. Avatar for Sammy3c2b1a0 67. Sammy3c2b1a0 Lv 1 1 pt. 9,690
  8. Avatar for apetrides 68. apetrides Lv 1 1 pt. 9,685
  9. Avatar for oxplough 69. oxplough Lv 1 1 pt. 9,677
  10. Avatar for Sunflower 70. Sunflower Lv 1 1 pt. 9,629

Comments