Icon representing a puzzle

2665: Revisiting Puzzle 165: Rosetta Model 15

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 2 pts. 11,070
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,007
  3. Avatar for Russian team 13. Russian team 1 pt. 10,573
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 10,521
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,274
  6. Avatar for Mahmut Oyunda 16. Mahmut Oyunda 1 pt. 10,126
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 9,734
  8. Avatar for People team 18. People team 1 pt. 9,732
  9. Avatar for BIOL2020AB Fall2025 19. BIOL2020AB Fall2025 1 pt. 8,370
  1. Avatar for Larini 51. Larini Lv 1 1 pt. 10,468
  2. Avatar for Trajan464 52. Trajan464 Lv 1 1 pt. 10,453
  3. Avatar for pfirth 53. pfirth Lv 1 1 pt. 10,433
  4. Avatar for carxo 54. carxo Lv 1 1 pt. 10,394
  5. Avatar for alipacka 55. alipacka Lv 1 1 pt. 10,346
  6. Avatar for NalesnikLD 56. NalesnikLD Lv 1 1 pt. 10,274
  7. Avatar for goldfish80 57. goldfish80 Lv 1 1 pt. 10,265
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 10,232
  9. Avatar for fikret 59. fikret Lv 1 1 pt. 10,126
  10. Avatar for Mohoernchen 60. Mohoernchen Lv 1 1 pt. 10,051

Comments