Icon representing a puzzle

2665: Revisiting Puzzle 165: Rosetta Model 15

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 2 pts. 11,070
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,007
  3. Avatar for Russian team 13. Russian team 1 pt. 10,573
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 10,521
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,274
  6. Avatar for Mahmut Oyunda 16. Mahmut Oyunda 1 pt. 10,126
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 9,734
  8. Avatar for People team 18. People team 1 pt. 9,732
  9. Avatar for BIOL2020AB Fall2025 19. BIOL2020AB Fall2025 1 pt. 8,370
  1. Avatar for Jeuxdit<3 71. Jeuxdit<3 Lv 1 1 pt. 9,769
  2. Avatar for mk_python 72. mk_python Lv 1 1 pt. 9,756
  3. Avatar for Sammy3c2b1a0 73. Sammy3c2b1a0 Lv 1 1 pt. 9,734
  4. Avatar for 31415cats 74. 31415cats Lv 1 1 pt. 9,732
  5. Avatar for I_IsJu 75. I_IsJu Lv 1 1 pt. 9,724
  6. Avatar for Swapper242 76. Swapper242 Lv 1 1 pt. 9,697
  7. Avatar for nabwio 77. nabwio Lv 1 1 pt. 9,151
  8. Avatar for origami_dragon707 78. origami_dragon707 Lv 1 1 pt. 8,864
  9. Avatar for PixelFurie 79. PixelFurie Lv 1 1 pt. 8,383
  10. Avatar for biran3166 80. biran3166 Lv 1 1 pt. 8,370

Comments