Icon representing a puzzle

2665: Revisiting Puzzle 165: Rosetta Model 15

Closed since 6 months ago

Novice Overall Prediction

Summary


Created
September 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 12,019
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,010
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 11,453
  4. Avatar for Contenders 4. Contenders 41 pts. 11,401
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 11,301
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 20 pts. 11,287
  7. Avatar for Australia 7. Australia 14 pts. 11,227
  8. Avatar for VeFold 8. VeFold 9 pts. 11,221
  9. Avatar for Marvin's bunch 9. Marvin's bunch 6 pts. 11,176
  10. Avatar for Team China 10. Team China 4 pts. 11,134

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,010
  2. Avatar for grogar7 2. grogar7 Lv 1 94 pts. 12,000
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 88 pts. 11,988
  4. Avatar for Serca 4. Serca Lv 1 83 pts. 11,879
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 78 pts. 11,799
  6. Avatar for Aarav_Awasthi 6. Aarav_Awasthi Lv 1 73 pts. 11,561
  7. Avatar for TheGUmmer 7. TheGUmmer Lv 1 68 pts. 11,453
  8. Avatar for akaaka 8. akaaka Lv 1 63 pts. 11,448
  9. Avatar for Dr. Goochie 9. Dr. Goochie Lv 1 59 pts. 11,443
  10. Avatar for bravosk8erboy 10. bravosk8erboy Lv 1 55 pts. 11,438

Comments