Icon representing a puzzle

2665: Revisiting Puzzle 165: Rosetta Model 15

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
September 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,019
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,010
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 11,453
  4. Avatar for Contenders 4. Contenders 41 pts. 11,401
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 11,301
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 20 pts. 11,287
  7. Avatar for Australia 7. Australia 14 pts. 11,227
  8. Avatar for VeFold 8. VeFold 9 pts. 11,221
  9. Avatar for Marvin's bunch 9. Marvin's bunch 6 pts. 11,176
  10. Avatar for Team China 10. Team China 4 pts. 11,134
  1. Avatar for Dr.Sillem 31. Dr.Sillem Lv 1 10 pts. 11,048
  2. Avatar for Anfinsen_slept_here 32. Anfinsen_slept_here Lv 1 9 pts. 11,044
  3. Avatar for aendgraend 33. aendgraend Lv 1 8 pts. 11,007
  4. Avatar for Apothecary1815 34. Apothecary1815 Lv 1 7 pts. 10,943
  5. Avatar for Joanna_H 35. Joanna_H Lv 1 6 pts. 10,941
  6. Avatar for heather-1 36. heather-1 Lv 1 6 pts. 10,848
  7. Avatar for Alistair69 37. Alistair69 Lv 1 5 pts. 10,842
  8. Avatar for KneelTheGrass 38. KneelTheGrass Lv 1 5 pts. 10,833
  9. Avatar for zxspectrum 39. zxspectrum Lv 1 4 pts. 10,822
  10. Avatar for alcor29 40. alcor29 Lv 1 4 pts. 10,755

Comments