Icon representing a puzzle

2677: Revisiting Puzzle 55: Scorpion Toxin

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 22, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 7,736
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,761
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 94 pts. 10,745
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 89 pts. 10,743
  4. Avatar for Serca 4. Serca Lv 1 83 pts. 10,735
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 78 pts. 10,692
  6. Avatar for grogar7 6. grogar7 Lv 1 73 pts. 10,692
  7. Avatar for SemperRabbit 7. SemperRabbit Lv 1 68 pts. 10,648
  8. Avatar for Xendrais 8. Xendrais Lv 1 64 pts. 10,607
  9. Avatar for Dr. Goochie 9. Dr. Goochie Lv 1 60 pts. 10,554
  10. Avatar for Galaxie 10. Galaxie Lv 1 56 pts. 10,454

Comments