Placeholder image of a protein
Icon representing a puzzle

2678: Electron Density Reconstruction 141

Closed since 6 months ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
October 22, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a large protein, and a small protein.

Sequence
MGSSHHHHHHSSGLVPRGSHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWA PRWSVLAGHSRTVSDSIKKLITSMR

Top groups


  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 32,917
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 17,510

  1. Avatar for Bletchley Park
    1. Bletchley Park Lv 1
    100 pts. 38,564
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 94 pts. 38,528
  3. Avatar for Galaxie 3. Galaxie Lv 1 87 pts. 38,471
  4. Avatar for LociOiling 4. LociOiling Lv 1 81 pts. 38,459
  5. Avatar for ichwilldiesennamen 5. ichwilldiesennamen Lv 1 76 pts. 38,443
  6. Avatar for Aarav_Awasthi 6. Aarav_Awasthi Lv 1 70 pts. 38,441
  7. Avatar for Dr. Goochie 7. Dr. Goochie Lv 1 65 pts. 38,439
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 60 pts. 38,386
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 56 pts. 38,381
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 52 pts. 38,376

Comments


LociOiling Lv 1

This puzzle appears to be a week and a day early.

Puzzle 2678 is set to become ED Recon 141 on the usual day.

Puzzle 2681 is ED Recon 142, which probably would launch October 30th, following the normal schedule.

Puzzle 2681 is only 274 segments, so it wouldn't seem to need extra time, although opinions might vary on that.

LociOiling Lv 1

Just to recap, this puzzle started out as 2681, ED Recon 142.

It's now been adjusted to be puzzle 2678, ED Recon 141.

The expiration date has also been adjusted, so it's now the usual Thursday expiration in North American time zones.

If you're already running it as 2681, you won't see the change to 2678 until you restart Foldit.

All your work should be preserved when you open the puzzle as 2678, although manual saves are always a good idea.