Placeholder image of a protein
Icon representing a puzzle

2678: Electron Density Reconstruction 141

Closed since 6 months ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
October 22, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a large protein, and a small protein.

Sequence
MGSSHHHHHHSSGLVPRGSHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWA PRWSVLAGHSRTVSDSIKKLITSMR

Top groups


  1. Avatar for Contenders 100 pts. 38,564
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 63 pts. 38,528
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 38,471
  4. Avatar for Go Science 4. Go Science 21 pts. 38,468
  5. Avatar for VeFold 5. VeFold 11 pts. 38,386
  6. Avatar for Australia 6. Australia 5 pts. 38,309
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 38,234
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 38,210
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 38,160
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 37,701

  1. Avatar for grogar7 11. grogar7 Lv 1 48 pts. 38,370
  2. Avatar for gmn 12. gmn Lv 1 44 pts. 38,346
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 41 pts. 38,311
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 37 pts. 38,309
  5. Avatar for nicobul 15. nicobul Lv 1 34 pts. 38,288
  6. Avatar for meatexplosion 16. meatexplosion Lv 1 32 pts. 38,284
  7. Avatar for akaaka 17. akaaka Lv 1 29 pts. 38,250
  8. Avatar for Xendrais 18. Xendrais Lv 1 27 pts. 38,244
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 24 pts. 38,234
  10. Avatar for TheGUmmer 20. TheGUmmer Lv 1 22 pts. 38,210

Comments


LociOiling Lv 1

This puzzle appears to be a week and a day early.

Puzzle 2678 is set to become ED Recon 141 on the usual day.

Puzzle 2681 is ED Recon 142, which probably would launch October 30th, following the normal schedule.

Puzzle 2681 is only 274 segments, so it wouldn't seem to need extra time, although opinions might vary on that.

LociOiling Lv 1

Just to recap, this puzzle started out as 2681, ED Recon 142.

It's now been adjusted to be puzzle 2678, ED Recon 141.

The expiration date has also been adjusted, so it's now the usual Thursday expiration in North American time zones.

If you're already running it as 2681, you won't see the change to 2678 until you restart Foldit.

All your work should be preserved when you open the puzzle as 2678, although manual saves are always a good idea.