Placeholder image of a protein
Icon representing a puzzle

2678: Electron Density Reconstruction 141

Closed since 5 months ago

Novice Overall Prediction Electron Density

Summary

Created
October 22, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a large protein, and a small protein.

Sequence
MGSSHHHHHHSSGLVPRGSHMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWA PRWSVLAGHSRTVSDSIKKLITSMR

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 38,564
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 63 pts. 38,528
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 38,471
  4. Avatar for Go Science 4. Go Science 21 pts. 38,468
  5. Avatar for VeFold 5. VeFold 11 pts. 38,386
  6. Avatar for Australia 6. Australia 5 pts. 38,309
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 38,234
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 38,210
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 38,160
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 37,701
  1. Avatar for Swapper242 61. Swapper242 Lv 1 1 pt. 35,631
  2. Avatar for Arlind1 62. Arlind1 Lv 1 1 pt. 35,602
  3. Avatar for moisex 63. moisex Lv 1 1 pt. 35,587
  4. Avatar for SileNTViP 64. SileNTViP Lv 1 1 pt. 35,290
  5. Avatar for Jeuxdit<3 65. Jeuxdit<3 Lv 1 1 pt. 34,469
  6. Avatar for Merf 66. Merf Lv 1 1 pt. 33,867
  7. Avatar for Esteban C 67. Esteban C Lv 1 1 pt. 33,623
  8. Avatar for HelpME 68. HelpME Lv 1 1 pt. 32,917
  9. Avatar for Lucero del Rosario 69. Lucero del Rosario Lv 1 1 pt. 28,973
  10. Avatar for equilibria 70. equilibria Lv 1 1 pt. 24,081

Comments

LociOiling Lv 1

This puzzle appears to be a week and a day early.

Puzzle 2678 is set to become ED Recon 141 on the usual day.

Puzzle 2681 is ED Recon 142, which probably would launch October 30th, following the normal schedule.

Puzzle 2681 is only 274 segments, so it wouldn't seem to need extra time, although opinions might vary on that.

LociOiling Lv 1

Just to recap, this puzzle started out as 2681, ED Recon 142.

It's now been adjusted to be puzzle 2678, ED Recon 141.

The expiration date has also been adjusted, so it's now the usual Thursday expiration in North American time zones.

If you're already running it as 2681, you won't see the change to 2678 until you restart Foldit.

All your work should be preserved when you open the puzzle as 2678, although manual saves are always a good idea.