Icon representing a puzzle

2680: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
October 29, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,532
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 7,919
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 7,900
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,700
  2. Avatar for LociOiling 2. LociOiling Lv 1 95 pts. 10,693
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 89 pts. 10,635
  4. Avatar for ichwilldiesennamen 4. ichwilldiesennamen Lv 1 84 pts. 10,627
  5. Avatar for nicobul 5. nicobul Lv 1 79 pts. 10,569
  6. Avatar for grogar7 6. grogar7 Lv 1 74 pts. 10,508
  7. Avatar for SemperRabbit 7. SemperRabbit Lv 1 69 pts. 10,490
  8. Avatar for bravosk8erboy 8. bravosk8erboy Lv 1 65 pts. 10,480
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 61 pts. 10,424
  10. Avatar for akaaka 10. akaaka Lv 1 57 pts. 10,416

Comments