Icon representing a puzzle

2680: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since 5 months ago

Novice Overall Prediction

Summary


Created
October 29, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Go Science 100 pts. 10,700
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,693
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 10,569
  4. Avatar for Contenders 4. Contenders 24 pts. 10,408
  5. Avatar for Australia 5. Australia 14 pts. 10,391
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 10,251
  7. Avatar for Gargleblasters 7. Gargleblasters 4 pts. 10,212
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 10,167
  9. Avatar for VeFold 9. VeFold 1 pt. 9,943
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,496

  1. Avatar for rinze 61. rinze Lv 1 1 pt. 8,323
  2. Avatar for majyunyan 62. majyunyan Lv 1 1 pt. 8,260
  3. Avatar for Alistair69 63. Alistair69 Lv 1 1 pt. 8,257
  4. Avatar for Steven Pletsch 64. Steven Pletsch Lv 1 1 pt. 8,247
  5. Avatar for efull 65. efull Lv 1 1 pt. 8,181
  6. Avatar for DScott 66. DScott Lv 1 1 pt. 8,152
  7. Avatar for Jenot96 67. Jenot96 Lv 1 1 pt. 8,087
  8. Avatar for Shadowmaster_ 69. Shadowmaster_ Lv 1 1 pt. 7,994
  9. Avatar for Jeshua Cuadros 70. Jeshua Cuadros Lv 1 1 pt. 7,951

Comments