Icon representing a puzzle

2686: Revisiting Puzzle 59: TCR Binding Protein

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,384
  2. Avatar for Team China 12. Team China 1 pt. 9,054
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,527
  4. Avatar for Bioqué? 14. Bioqué? 1 pt. 8,513
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,201
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 10,151
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 88 pts. 10,134
  4. Avatar for ichwilldiesennamen 4. ichwilldiesennamen Lv 1 82 pts. 10,116
  5. Avatar for Galaxie 5. Galaxie Lv 1 76 pts. 10,115
  6. Avatar for SemperRabbit 6. SemperRabbit Lv 1 71 pts. 10,101
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 66 pts. 10,089
  8. Avatar for gmn 8. gmn Lv 1 61 pts. 10,084
  9. Avatar for nicobul 9. nicobul Lv 1 56 pts. 10,078
  10. Avatar for BootsMcGraw 10. BootsMcGraw Lv 1 52 pts. 10,078

Comments