Icon representing a puzzle

2686: Revisiting Puzzle 59: TCR Binding Protein

Closed since 5 months ago

Novice Overall Prediction

Summary


Created
November 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,201
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,153
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,078
  4. Avatar for Contenders 4. Contenders 27 pts. 10,078
  5. Avatar for VeFold 5. VeFold 16 pts. 9,920
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,893
  7. Avatar for Australia 7. Australia 5 pts. 9,889
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,882
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,815
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,752

  1. Avatar for bravosk8erboy 11. bravosk8erboy Lv 1 48 pts. 10,074
  2. Avatar for christioanchauvin 12. christioanchauvin Lv 1 45 pts. 10,058
  3. Avatar for Aarav_Awasthi 13. Aarav_Awasthi Lv 1 41 pts. 10,055
  4. Avatar for g_b 14. g_b Lv 1 38 pts. 10,049
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 35 pts. 10,016
  6. Avatar for Dr. Goochie 16. Dr. Goochie Lv 1 32 pts. 10,001
  7. Avatar for zxspectrum 17. zxspectrum Lv 1 30 pts. 9,999
  8. Avatar for georg137 18. georg137 Lv 1 27 pts. 9,953
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 25 pts. 9,946
  10. Avatar for akaaka 20. akaaka Lv 1 23 pts. 9,946

Comments