Icon representing a puzzle

2689: Revisiting Puzzle 60: Beta Barrel

Closed since 5 months ago

Novice Overall Prediction

Summary


Created
November 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Go Science 100 pts. 12,846
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 12,790
  3. Avatar for VeFold 3. VeFold 41 pts. 12,633
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 12,470
  5. Avatar for Australia 5. Australia 14 pts. 12,468
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,466
  7. Avatar for Contenders 7. Contenders 4 pts. 12,332
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 12,294
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 11,781
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 11,056

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 12,846
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 12,789
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 89 pts. 12,733
  4. Avatar for ichwilldiesennamen 4. ichwilldiesennamen Lv 1 83 pts. 12,680
  5. Avatar for Xendrais 5. Xendrais Lv 1 78 pts. 12,633
  6. Avatar for bravosk8erboy 6. bravosk8erboy Lv 1 73 pts. 12,620
  7. Avatar for akaaka 7. akaaka Lv 1 69 pts. 12,603
  8. Avatar for SemperRabbit 8. SemperRabbit Lv 1 64 pts. 12,601
  9. Avatar for gmn 9. gmn Lv 1 60 pts. 12,597
  10. Avatar for dpmattingly 10. dpmattingly Lv 1 56 pts. 12,529

Comments