Placeholder image of a protein
Icon representing a puzzle

2696: Electron Density Reconstruction 147

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has both protein and DNA components, and comes from PDB entry 2DPU.

Sequence
MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF CTATGAACATT ATGTTCATAG

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 22,839
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 22,810
  3. Avatar for Antharis Therapeutics 13. Antharis Therapeutics 1 pt. 22,743
  4. Avatar for Ubuntu 14. Ubuntu 1 pt. 22,652

  1. Avatar for Aarav_Awasthi
    1. Aarav_Awasthi Lv 1
    100 pts. 24,708
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 94 pts. 24,683
  3. Avatar for LociOiling 3. LociOiling Lv 1 88 pts. 24,677
  4. Avatar for Galaxie 4. Galaxie Lv 1 82 pts. 24,653
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 76 pts. 24,637
  6. Avatar for grogar7 6. grogar7 Lv 1 71 pts. 24,615
  7. Avatar for Dr. Goochie 7. Dr. Goochie Lv 1 66 pts. 24,598
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 61 pts. 24,584
  9. Avatar for ichwilldiesennamen 9. ichwilldiesennamen Lv 1 57 pts. 24,583
  10. Avatar for g_b 10. g_b Lv 1 53 pts. 24,573

Comments