Placeholder image of a protein
Icon representing a puzzle

2696: Electron Density Reconstruction 147

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has both protein and DNA components, and comes from PDB entry 2DPU.

Sequence
MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF CTATGAACATT ATGTTCATAG

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 22,839
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 22,810
  3. Avatar for Antharis Therapeutics 13. Antharis Therapeutics 1 pt. 22,743
  4. Avatar for Ubuntu 14. Ubuntu 1 pt. 22,652
  1. Avatar for BarrySampson 21. BarrySampson Lv 1 21 pts. 24,492
  2. Avatar for Elfi 22. Elfi Lv 1 19 pts. 24,484
  3. Avatar for SemperRabbit 23. SemperRabbit Lv 1 18 pts. 24,481
  4. Avatar for gmn 24. gmn Lv 1 16 pts. 24,473
  5. Avatar for BootsMcGraw 25. BootsMcGraw Lv 1 15 pts. 24,451
  6. Avatar for westchuck 26. westchuck Lv 1 13 pts. 24,449
  7. Avatar for bravosk8erboy 27. bravosk8erboy Lv 1 12 pts. 24,434
  8. Avatar for TheGUmmer 28. TheGUmmer Lv 1 11 pts. 24,429
  9. Avatar for silent gene 29. silent gene Lv 1 10 pts. 24,424
  10. Avatar for dpmattingly 30. dpmattingly Lv 1 9 pts. 24,407

Comments