Placeholder image of a protein
Icon representing a puzzle

2696: Electron Density Reconstruction 147

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has both protein and DNA components, and comes from PDB entry 2DPU.

Sequence
MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF CTATGAACATT ATGTTCATAG

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 22,839
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 22,810
  3. Avatar for Antharis Therapeutics 13. Antharis Therapeutics 1 pt. 22,743
  4. Avatar for Ubuntu 14. Ubuntu 1 pt. 22,652
  1. Avatar for Wildice1100 51. Wildice1100 Lv 1 1 pt. 23,576
  2. Avatar for zbp 52. zbp Lv 1 1 pt. 23,560
  3. Avatar for pfirth 53. pfirth Lv 1 1 pt. 23,531
  4. Avatar for ZiiONIC 54. ZiiONIC Lv 1 1 pt. 23,454
  5. Avatar for Merf 55. Merf Lv 1 1 pt. 23,160
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 22,903
  7. Avatar for Mohoernchen 57. Mohoernchen Lv 1 1 pt. 22,891
  8. Avatar for rinze 58. rinze Lv 1 1 pt. 22,840
  9. Avatar for Sammy3c2b1a0 59. Sammy3c2b1a0 Lv 1 1 pt. 22,839
  10. Avatar for Savas 60. Savas Lv 1 1 pt. 22,810

Comments