Placeholder image of a protein
Icon representing a puzzle

2696: Electron Density Reconstruction 147

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has both protein and DNA components, and comes from PDB entry 2DPU.

Sequence
MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF CTATGAACATT ATGTTCATAG

Top groups


  1. Avatar for Go Science 100 pts. 24,708
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 24,687
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 24,683
  4. Avatar for Contenders 4. Contenders 27 pts. 24,548
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 24,542
  6. Avatar for Australia 6. Australia 9 pts. 24,536
  7. Avatar for VeFold 7. VeFold 5 pts. 24,527
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 24,520
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 24,429
  10. Avatar for Team China 10. Team China 1 pt. 24,135

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 24,687
  2. Avatar for LociOiling 2. LociOiling Lv 1 56 pts. 24,678
  3. Avatar for SemperRabbit 3. SemperRabbit Lv 1 29 pts. 24,660
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 14 pts. 24,642
  5. Avatar for Dr. Goochie 5. Dr. Goochie Lv 1 6 pts. 24,628
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 2 pts. 24,612
  7. Avatar for toshiue 7. toshiue Lv 1 1 pt. 24,608
  8. Avatar for nicobul 8. nicobul Lv 1 1 pt. 24,591
  9. Avatar for silent gene 9. silent gene Lv 1 1 pt. 24,581
  10. Avatar for Zhang Ruichong 10. Zhang Ruichong Lv 1 1 pt. 24,348

Comments