Placeholder image of a protein
Icon representing a puzzle

2696: Electron Density Reconstruction 147

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has both protein and DNA components, and comes from PDB entry 2DPU.

Sequence
MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF CTATGAACATT ATGTTCATAG

Top groups


  1. Avatar for Go Science 100 pts. 24,708
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 24,687
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 24,683
  4. Avatar for Contenders 4. Contenders 27 pts. 24,548
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 24,542
  6. Avatar for Australia 6. Australia 9 pts. 24,536
  7. Avatar for VeFold 7. VeFold 5 pts. 24,527
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 24,520
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 24,429
  10. Avatar for Team China 10. Team China 1 pt. 24,135

  1. Avatar for Moolanie 41. Moolanie Lv 1 3 pts. 23,991
  2. Avatar for hada 42. hada Lv 1 2 pts. 23,928
  3. Avatar for BeatriceGrace 43. BeatriceGrace Lv 1 2 pts. 23,839
  4. Avatar for Floddi 44. Floddi Lv 1 2 pts. 23,752
  5. Avatar for ProfVince 45. ProfVince Lv 1 2 pts. 23,749
  6. Avatar for Trajan464 46. Trajan464 Lv 1 1 pt. 23,730
  7. Avatar for carxo 47. carxo Lv 1 1 pt. 23,696
  8. Avatar for Larini 48. Larini Lv 1 1 pt. 23,681
  9. Avatar for Fasodankfds 49. Fasodankfds Lv 1 1 pt. 23,648
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 1 pt. 23,591

Comments