Placeholder image of a protein
Icon representing a puzzle

2699: Electron Density Reconstruction 148

Closed since 4 months ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 03, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has three chains, and comes from PDB entry 2EQB.

Sequence
GPLGSNYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDT GPLGSSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSN

Top groups


  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 49,269

  1. Avatar for ichwilldiesennamen 100 pts. 51,466
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 93 pts. 51,458
  3. Avatar for LociOiling 3. LociOiling Lv 1 86 pts. 51,421
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 79 pts. 51,420
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 73 pts. 51,395
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 68 pts. 51,352
  7. Avatar for gmn 7. gmn Lv 1 62 pts. 51,336
  8. Avatar for Dr. Goochie 8. Dr. Goochie Lv 1 57 pts. 51,328
  9. Avatar for Aarav_Awasthi 9. Aarav_Awasthi Lv 1 52 pts. 51,316
  10. Avatar for Galaxie 10. Galaxie Lv 1 48 pts. 51,295

Comments