Placeholder image of a protein
Icon representing a puzzle

2699: Electron Density Reconstruction 148

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 03, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has three chains, and comes from PDB entry 2EQB.

Sequence
GPLGSNYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDT GPLGSSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSN

Top groups

  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 49,269
  1. Avatar for ZeroLeak7 11. ZeroLeak7 Lv 1 44 pts. 51,288
  2. Avatar for Elfi 12. Elfi Lv 1 40 pts. 51,256
  3. Avatar for Zhang Ruichong 13. Zhang Ruichong Lv 1 37 pts. 51,246
  4. Avatar for georg137 14. georg137 Lv 1 33 pts. 51,239
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 30 pts. 51,167
  6. Avatar for grogar7 16. grogar7 Lv 1 27 pts. 51,166
  7. Avatar for nicobul 17. nicobul Lv 1 25 pts. 51,157
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 22 pts. 51,145
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 20 pts. 51,132
  10. Avatar for SemperRabbit 20. SemperRabbit Lv 1 18 pts. 51,121

Comments