Placeholder image of a protein
Icon representing a puzzle

2699: Electron Density Reconstruction 148

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 03, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has three chains, and comes from PDB entry 2EQB.

Sequence
GPLGSNYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDT GPLGSSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSN

Top groups

  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 49,269
  1. Avatar for alcor29 31. alcor29 Lv 1 5 pts. 50,847
  2. Avatar for majyunyan 32. majyunyan Lv 1 4 pts. 50,815
  3. Avatar for TheGUmmer 33. TheGUmmer Lv 1 4 pts. 50,808
  4. Avatar for meatexplosion 34. meatexplosion Lv 1 3 pts. 50,783
  5. Avatar for zxspectrum 35. zxspectrum Lv 1 3 pts. 50,570
  6. Avatar for jausmh 36. jausmh Lv 1 3 pts. 50,481
  7. Avatar for Dr.Sillem 37. Dr.Sillem Lv 1 2 pts. 50,370
  8. Avatar for manu8170 38. manu8170 Lv 1 2 pts. 50,211
  9. Avatar for Trajan464 39. Trajan464 Lv 1 2 pts. 50,159
  10. Avatar for rosie4loop 40. rosie4loop Lv 1 2 pts. 50,114

Comments