Placeholder image of a protein
Icon representing a puzzle

2699: Electron Density Reconstruction 148

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 03, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has three chains, and comes from PDB entry 2EQB.

Sequence
GPLGSNYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDT GPLGSSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSN

Top groups


  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 49,269

  1. Avatar for carxo 41. carxo Lv 1 1 pt. 50,097
  2. Avatar for ucad 43. ucad Lv 1 1 pt. 50,077
  3. Avatar for Joanna_H 44. Joanna_H Lv 1 1 pt. 50,022
  4. Avatar for jamiexq 45. jamiexq Lv 1 1 pt. 49,941
  5. Avatar for carsonfb 46. carsonfb Lv 1 1 pt. 49,869
  6. Avatar for Fasodankfds 47. Fasodankfds Lv 1 1 pt. 49,812
  7. Avatar for hada 48. hada Lv 1 1 pt. 49,793
  8. Avatar for abiogenesis 49. abiogenesis Lv 1 1 pt. 49,636
  9. Avatar for Idiotboy 50. Idiotboy Lv 1 1 pt. 49,583

Comments