Placeholder image of a protein
Icon representing a puzzle

2699: Electron Density Reconstruction 148

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 03, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has three chains, and comes from PDB entry 2EQB.

Sequence
GPLGSNYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDT GPLGSSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSN

Top groups

  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 49,269
  1. Avatar for pfirth 51. pfirth Lv 1 1 pt. 49,413
  2. Avatar for toshiue 52. toshiue Lv 1 1 pt. 49,352
  3. Avatar for rovergaard 53. rovergaard Lv 1 1 pt. 49,269
  4. Avatar for zbp 54. zbp Lv 1 1 pt. 49,223
  5. Avatar for Flagg65a 55. Flagg65a Lv 1 1 pt. 48,871
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 48,734
  7. Avatar for ZiiONIC 57. ZiiONIC Lv 1 1 pt. 48,729
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 48,587
  9. Avatar for RWoodcock 59. RWoodcock Lv 1 1 pt. 48,212
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 48,130

Comments