Placeholder image of a protein
Icon representing a puzzle

2699: Electron Density Reconstruction 148

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 03, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has three chains, and comes from PDB entry 2EQB.

Sequence
GPLGSNYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDT GPLGSSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSN

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 51,466
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 60 pts. 51,458
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 33 pts. 51,439
  4. Avatar for Contenders 4. Contenders 17 pts. 51,420
  5. Avatar for VeFold 5. VeFold 8 pts. 51,288
  6. Avatar for Australia 6. Australia 4 pts. 51,167
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 51,145
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 50,808
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 50,481
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 50,022
  1. Avatar for toshiue
    1. toshiue Lv 1
    100 pts. 51,465
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 56 pts. 51,465
  3. Avatar for silent gene 3. silent gene Lv 1 29 pts. 51,455
  4. Avatar for Galaxie 4. Galaxie Lv 1 14 pts. 51,439
  5. Avatar for Bletchley Park 5. Bletchley Park Lv 1 6 pts. 51,410
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 2 pts. 51,408
  7. Avatar for Dr. Goochie 7. Dr. Goochie Lv 1 1 pt. 51,405
  8. Avatar for LociOiling 8. LociOiling Lv 1 1 pt. 51,402
  9. Avatar for alcor29 9. alcor29 Lv 1 1 pt. 51,370
  10. Avatar for Zhang Ruichong 10. Zhang Ruichong Lv 1 1 pt. 51,020

Comments