Placeholder image of a protein
Icon representing a puzzle

2699: Electron Density Reconstruction 148

Closed since 4 months ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 03, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has three chains, and comes from PDB entry 2EQB.

Sequence
GPLGSNYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDT GPLGSSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSN

Top groups


  1. Avatar for Go Science 100 pts. 51,466
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 60 pts. 51,458
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 33 pts. 51,439
  4. Avatar for Contenders 4. Contenders 17 pts. 51,420
  5. Avatar for VeFold 5. VeFold 8 pts. 51,288
  6. Avatar for Australia 6. Australia 4 pts. 51,167
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 51,145
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 50,808
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 50,481
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 50,022

  1. Avatar for ZeroLeak7 11. ZeroLeak7 Lv 1 44 pts. 51,288
  2. Avatar for Elfi 12. Elfi Lv 1 40 pts. 51,256
  3. Avatar for Zhang Ruichong 13. Zhang Ruichong Lv 1 37 pts. 51,246
  4. Avatar for georg137 14. georg137 Lv 1 33 pts. 51,239
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 30 pts. 51,167
  6. Avatar for grogar7 16. grogar7 Lv 1 27 pts. 51,166
  7. Avatar for nicobul 17. nicobul Lv 1 25 pts. 51,157
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 22 pts. 51,145
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 20 pts. 51,132
  10. Avatar for SemperRabbit 20. SemperRabbit Lv 1 18 pts. 51,121

Comments