Placeholder image of a protein
Icon representing a puzzle

2699: Electron Density Reconstruction 148

Closed since 4 months ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 03, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has three chains, and comes from PDB entry 2EQB.

Sequence
GPLGSNYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDT GPLGSSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSN

Top groups


  1. Avatar for Go Science 100 pts. 51,466
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 60 pts. 51,458
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 33 pts. 51,439
  4. Avatar for Contenders 4. Contenders 17 pts. 51,420
  5. Avatar for VeFold 5. VeFold 8 pts. 51,288
  6. Avatar for Australia 6. Australia 4 pts. 51,167
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 51,145
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 50,808
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 50,481
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 50,022

  1. Avatar for westchuck 21. westchuck Lv 1 16 pts. 51,095
  2. Avatar for dpmattingly 22. dpmattingly Lv 1 15 pts. 51,057
  3. Avatar for akaaka 23. akaaka Lv 1 13 pts. 51,019
  4. Avatar for BarrySampson 24. BarrySampson Lv 1 12 pts. 51,016
  5. Avatar for spvincent 25. spvincent Lv 1 10 pts. 51,014
  6. Avatar for g_b 26. g_b Lv 1 9 pts. 51,009
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 8 pts. 50,979
  8. Avatar for BootsMcGraw 28. BootsMcGraw Lv 1 7 pts. 50,962
  9. Avatar for Xendrais 29. Xendrais Lv 1 6 pts. 50,900
  10. Avatar for silent gene 30. silent gene Lv 1 6 pts. 50,885

Comments