Placeholder image of a protein
Icon representing a puzzle

2699: Electron Density Reconstruction 148

Closed since 4 months ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 03, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has three chains, and comes from PDB entry 2EQB.

Sequence
GPLGSNYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARKEKYAIEILNKRLTEQLREKDT GPLGSSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSN

Top groups


  1. Avatar for Go Science 100 pts. 51,466
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 60 pts. 51,458
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 33 pts. 51,439
  4. Avatar for Contenders 4. Contenders 17 pts. 51,420
  5. Avatar for VeFold 5. VeFold 8 pts. 51,288
  6. Avatar for Australia 6. Australia 4 pts. 51,167
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 51,145
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 50,808
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 50,481
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 50,022

  1. Avatar for pfirth 51. pfirth Lv 1 1 pt. 49,413
  2. Avatar for toshiue 52. toshiue Lv 1 1 pt. 49,352
  3. Avatar for rovergaard 53. rovergaard Lv 1 1 pt. 49,269
  4. Avatar for zbp 54. zbp Lv 1 1 pt. 49,223
  5. Avatar for Flagg65a 55. Flagg65a Lv 1 1 pt. 48,871
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 48,734
  7. Avatar for ZiiONIC 57. ZiiONIC Lv 1 1 pt. 48,729
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 48,587
  9. Avatar for RWoodcock 59. RWoodcock Lv 1 1 pt. 48,212
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 48,130

Comments