Icon representing a puzzle

2698: Revisiting Puzzle 63: Spinach Protein

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,132
  2. Avatar for Team China 12. Team China 1 pt. 8,639
  3. Avatar for BPS_2025 13. BPS_2025 1 pt. 6,616
  4. Avatar for Ubuntu 14. Ubuntu 1 pt. 6,119
  1. Avatar for majyunyan 31. majyunyan Lv 1 8 pts. 10,758
  2. Avatar for alcor29 32. alcor29 Lv 1 7 pts. 10,729
  3. Avatar for Joanna_H 33. Joanna_H Lv 1 7 pts. 10,728
  4. Avatar for BarrySampson 34. BarrySampson Lv 1 6 pts. 10,664
  5. Avatar for silent gene 35. silent gene Lv 1 5 pts. 10,649
  6. Avatar for Dr.Sillem 36. Dr.Sillem Lv 1 5 pts. 10,631
  7. Avatar for carxo 37. carxo Lv 1 4 pts. 10,513
  8. Avatar for jamiexq 38. jamiexq Lv 1 4 pts. 10,432
  9. Avatar for zbp 39. zbp Lv 1 3 pts. 10,397
  10. Avatar for abiogenesis 40. abiogenesis Lv 1 3 pts. 10,337

Comments