Icon representing a puzzle

2698: Revisiting Puzzle 63: Spinach Protein

Closed since 3 months ago

Novice Overall Prediction

Summary


Created
December 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,132
  2. Avatar for Team China 12. Team China 1 pt. 8,639
  3. Avatar for BPS_2025 13. BPS_2025 1 pt. 6,616
  4. Avatar for Ubuntu 14. Ubuntu 1 pt. 6,119

  1. Avatar for rosie4loop 51. rosie4loop Lv 1 1 pt. 9,903
  2. Avatar for carsonfb 52. carsonfb Lv 1 1 pt. 9,779
  3. Avatar for Mohoernchen 53. Mohoernchen Lv 1 1 pt. 9,668
  4. Avatar for Zhang Ruichong 54. Zhang Ruichong Lv 1 1 pt. 9,599
  5. Avatar for DScott 55. DScott Lv 1 1 pt. 9,465
  6. Avatar for LadyCrazy 56. LadyCrazy Lv 1 1 pt. 8,639
  7. Avatar for Brenton_P 57. Brenton_P Lv 1 1 pt. 8,385
  8. Avatar for RWoodcock 58. RWoodcock Lv 1 1 pt. 8,368
  9. Avatar for meatexplosion 60. meatexplosion Lv 1 1 pt. 8,265

Comments