Icon representing a puzzle

2698: Revisiting Puzzle 63: Spinach Protein

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,132
  2. Avatar for Team China 12. Team China 1 pt. 8,639
  3. Avatar for BPS_2025 13. BPS_2025 1 pt. 6,616
  4. Avatar for Ubuntu 14. Ubuntu 1 pt. 6,119
  1. Avatar for heather-1 61. heather-1 Lv 1 1 pt. 7,758
  2. Avatar for yojo 62. yojo Lv 1 1 pt. 7,064
  3. Avatar for Kante 63. Kante Lv 1 1 pt. 6,838
  4. Avatar for taurine511 64. taurine511 Lv 1 1 pt. 6,725
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 6,687
  6. Avatar for zhengyichen 66. zhengyichen Lv 1 1 pt. 6,631
  7. Avatar for poltix 67. poltix Lv 1 1 pt. 6,616
  8. Avatar for <someone> 68. <someone> Lv 1 1 pt. 6,565
  9. Avatar for rzrbladess 69. rzrbladess Lv 1 1 pt. 6,535
  10. Avatar for toshiue 70. toshiue Lv 1 1 pt. 6,466

Comments