Icon representing a puzzle

2698: Revisiting Puzzle 63: Spinach Protein

Closed since 5 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,132
  2. Avatar for Team China 12. Team China 1 pt. 8,639
  3. Avatar for BPS_2025 13. BPS_2025 1 pt. 6,616
  4. Avatar for Ubuntu 14. Ubuntu 1 pt. 6,119

  1. Avatar for Hatemeloveme 71. Hatemeloveme Lv 1 1 pt. 6,463
  2. Avatar for Matrena 72. Matrena Lv 1 1 pt. 6,267
  3. Avatar for yushiuan9499 73. yushiuan9499 Lv 1 1 pt. 6,119
  4. Avatar for apetrides 74. apetrides Lv 1 1 pt. 5,984
  5. Avatar for prkfour 75. prkfour Lv 1 1 pt. 4,173
  6. Avatar for spvincent 76. spvincent Lv 1 1 pt. 0

Comments