Icon representing a puzzle

2698: Revisiting Puzzle 63: Spinach Protein

Closed since 6 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Go Science 100 pts. 11,335
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,310
  3. Avatar for VeFold 3. VeFold 44 pts. 11,278
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,227
  5. Avatar for Australia 5. Australia 16 pts. 11,127
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,005
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 10,966
  8. Avatar for Contenders 8. Contenders 3 pts. 10,927
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,806
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,728

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 11,335
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 11,310
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 88 pts. 11,278
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 82 pts. 11,272
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 77 pts. 11,262
  6. Avatar for grogar7 6. grogar7 Lv 1 71 pts. 11,242
  7. Avatar for Aarav_Awasthi 7. Aarav_Awasthi Lv 1 66 pts. 11,236
  8. Avatar for nicobul 8. nicobul Lv 1 62 pts. 11,227
  9. Avatar for SemperRabbit 9. SemperRabbit Lv 1 57 pts. 11,226
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 53 pts. 11,218

Comments