Placeholder image of a protein
Icon representing a puzzle

2705: Electron Density Reconstruction 150

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 17, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains, and comes from PDB entry 2GFP. It's large, so the trim tool is recommended.

Sequence
LLLMLVLLVAVGQMAQTIYIPAIADMARDLNVREGAVQSVMGAYLLTYGVSQLFYGPISDRVGRRPVILVGMSIFMLATLVAVTTSSLTVLIAASAMQGMGTGVGGVMARTLPRDLYERTQLRHANSLLNMGILVSPLLAPLIGGLLDTMWNWRACYLFLLVLCAGVTFSMARWMPETRPVDAPRTRLLTSYKTLFGNSGFNCYLLMLIGGLAGIAAFEACSGVLMGAVLGLSSMTVSILFILPIPAAFFGAWFAGRPNKRFSTLMWQSVICCLLAGLLMWIPDWFGVMNVWTLLVPAALFFFGAGMLFPLATSGAMEPFPFLAGTAGALVGGLQNIGSGVLASLSAMLPQTGQGSLGLLMTLMGLLIVLCWLPL

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 51,207
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 49,687
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 48,671
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 11,643

  1. Avatar for akaaka
    1. akaaka Lv 1
    100 pts. 62,447
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 93 pts. 62,029
  3. Avatar for LociOiling 3. LociOiling Lv 1 86 pts. 61,955
  4. Avatar for Galaxie 4. Galaxie Lv 1 80 pts. 61,933
  5. Avatar for Dr. Goochie 5. Dr. Goochie Lv 1 74 pts. 61,168
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 68 pts. 60,874
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 63 pts. 60,766
  8. Avatar for spvincent 8. spvincent Lv 1 58 pts. 60,682
  9. Avatar for Aarav_Awasthi 9. Aarav_Awasthi Lv 1 53 pts. 60,602
  10. Avatar for bravosk8erboy 10. bravosk8erboy Lv 1 49 pts. 60,547

Comments


rmoretti Staff Lv 1

When experimentalists determine the density, they get the results for the "asymmetric unit" (the repeating unit which makes up the crystal structure). Sometimes this can contain more than one identical chain. Sometimes these repeated chains in the asymmetric unit are in the same structure, but sometimes there's significant structural differences between the two copies (which reflects itself in a difference in the density). As such, when you're figuring out the structure from the density, you have to treat the two halves of the density differently, modeling each with an independent chain.

If things are getting too large – to the point where it's inhibiting your ability to work on this (or any) puzzle, even when using trim – please let us know. There are possible work-arounds (like segmenting the density into two puzzles), but we're likely to get better scientific results by modeling both chains at once.