Placeholder image of a protein
Icon representing a puzzle

2705: Electron Density Reconstruction 150

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 17, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains, and comes from PDB entry 2GFP. It's large, so the trim tool is recommended.

Sequence
LLLMLVLLVAVGQMAQTIYIPAIADMARDLNVREGAVQSVMGAYLLTYGVSQLFYGPISDRVGRRPVILVGMSIFMLATLVAVTTSSLTVLIAASAMQGMGTGVGGVMARTLPRDLYERTQLRHANSLLNMGILVSPLLAPLIGGLLDTMWNWRACYLFLLVLCAGVTFSMARWMPETRPVDAPRTRLLTSYKTLFGNSGFNCYLLMLIGGLAGIAAFEACSGVLMGAVLGLSSMTVSILFILPIPAAFFGAWFAGRPNKRFSTLMWQSVICCLLAGLLMWIPDWFGVMNVWTLLVPAALFFFGAGMLFPLATSGAMEPFPFLAGTAGALVGGLQNIGSGVLASLSAMLPQTGQGSLGLLMTLMGLLIVLCWLPL

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 62,029
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 61,965
  3. Avatar for Contenders 3. Contenders 44 pts. 61,738
  4. Avatar for Go Science 4. Go Science 27 pts. 61,168
  5. Avatar for VeFold 5. VeFold 16 pts. 60,874
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 59,775
  7. Avatar for Australia 7. Australia 5 pts. 58,864
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 57,189
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 57,081
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 54,202

  1. Avatar for grogar7 21. grogar7 Lv 1 17 pts. 58,670
  2. Avatar for majyunyan 22. majyunyan Lv 1 16 pts. 58,544
  3. Avatar for westchuck 23. westchuck Lv 1 14 pts. 58,429
  4. Avatar for Zhang Ruichong 24. Zhang Ruichong Lv 1 13 pts. 57,711
  5. Avatar for dcrwheeler 25. dcrwheeler Lv 1 11 pts. 57,704
  6. Avatar for BarrySampson 26. BarrySampson Lv 1 10 pts. 57,622
  7. Avatar for georg137 27. georg137 Lv 1 9 pts. 57,504
  8. Avatar for jausmh 28. jausmh Lv 1 8 pts. 57,189
  9. Avatar for TheGUmmer 29. TheGUmmer Lv 1 7 pts. 57,081
  10. Avatar for dpmattingly 30. dpmattingly Lv 1 6 pts. 57,027

Comments


rmoretti Staff Lv 1

When experimentalists determine the density, they get the results for the "asymmetric unit" (the repeating unit which makes up the crystal structure). Sometimes this can contain more than one identical chain. Sometimes these repeated chains in the asymmetric unit are in the same structure, but sometimes there's significant structural differences between the two copies (which reflects itself in a difference in the density). As such, when you're figuring out the structure from the density, you have to treat the two halves of the density differently, modeling each with an independent chain.

If things are getting too large – to the point where it's inhibiting your ability to work on this (or any) puzzle, even when using trim – please let us know. There are possible work-arounds (like segmenting the density into two puzzles), but we're likely to get better scientific results by modeling both chains at once.