Placeholder image of a protein
Icon representing a puzzle

2705: Electron Density Reconstruction 150

Closed since 5 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
December 17, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains, and comes from PDB entry 2GFP. It's large, so the trim tool is recommended.

Sequence
LLLMLVLLVAVGQMAQTIYIPAIADMARDLNVREGAVQSVMGAYLLTYGVSQLFYGPISDRVGRRPVILVGMSIFMLATLVAVTTSSLTVLIAASAMQGMGTGVGGVMARTLPRDLYERTQLRHANSLLNMGILVSPLLAPLIGGLLDTMWNWRACYLFLLVLCAGVTFSMARWMPETRPVDAPRTRLLTSYKTLFGNSGFNCYLLMLIGGLAGIAAFEACSGVLMGAVLGLSSMTVSILFILPIPAAFFGAWFAGRPNKRFSTLMWQSVICCLLAGLLMWIPDWFGVMNVWTLLVPAALFFFGAGMLFPLATSGAMEPFPFLAGTAGALVGGLQNIGSGVLASLSAMLPQTGQGSLGLLMTLMGLLIVLCWLPL

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 62,029
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 61,965
  3. Avatar for Contenders 3. Contenders 44 pts. 61,738
  4. Avatar for Go Science 4. Go Science 27 pts. 61,168
  5. Avatar for VeFold 5. VeFold 16 pts. 60,874
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 59,775
  7. Avatar for Australia 7. Australia 5 pts. 58,864
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 57,189
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 57,081
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 54,202

  1. Avatar for nicobul 31. nicobul Lv 1 6 pts. 56,375
  2. Avatar for manu8170 32. manu8170 Lv 1 5 pts. 56,231
  3. Avatar for NinjaGreg 33. NinjaGreg Lv 1 4 pts. 56,189
  4. Avatar for Anfinsen_slept_here 34. Anfinsen_slept_here Lv 1 4 pts. 56,092
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 3 pts. 56,003
  6. Avatar for rosie4loop 36. rosie4loop Lv 1 3 pts. 55,062
  7. Avatar for Floddi 37. Floddi Lv 1 3 pts. 54,571
  8. Avatar for zxspectrum 38. zxspectrum Lv 1 2 pts. 54,355
  9. Avatar for Joanna_H 39. Joanna_H Lv 1 2 pts. 54,202
  10. Avatar for Trajan464 40. Trajan464 Lv 1 2 pts. 54,119

Comments


rmoretti Staff Lv 1

When experimentalists determine the density, they get the results for the "asymmetric unit" (the repeating unit which makes up the crystal structure). Sometimes this can contain more than one identical chain. Sometimes these repeated chains in the asymmetric unit are in the same structure, but sometimes there's significant structural differences between the two copies (which reflects itself in a difference in the density). As such, when you're figuring out the structure from the density, you have to treat the two halves of the density differently, modeling each with an independent chain.

If things are getting too large – to the point where it's inhibiting your ability to work on this (or any) puzzle, even when using trim – please let us know. There are possible work-arounds (like segmenting the density into two puzzles), but we're likely to get better scientific results by modeling both chains at once.