Icon representing a puzzle

2710: Revisiting Puzzle 68: Bos Taurus

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
January 07, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 9,823
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 7,317
  3. Avatar for BearCorp 13. BearCorp 1 pt. 4,858
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,855
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 60 pts. 10,855
  3. Avatar for silent gene 3. silent gene Lv 1 33 pts. 10,851
  4. Avatar for toshiue 4. toshiue Lv 1 17 pts. 10,850
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 8 pts. 10,849
  6. Avatar for Dr. Goochie 6. Dr. Goochie Lv 1 4 pts. 10,834
  7. Avatar for Galaxie 7. Galaxie Lv 1 2 pts. 10,831
  8. Avatar for LociOiling 8. LociOiling Lv 1 1 pt. 10,819
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 1 pt. 10,767
  10. Avatar for georg137 10. georg137 Lv 1 1 pt. 10,646

Comments