Icon representing a puzzle

2710: Revisiting Puzzle 68: Bos Taurus

Closed since 3 months ago

Novice Overall Prediction

Summary


Created
January 07, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 9,823
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 7,317
  3. Avatar for BearCorp 13. BearCorp 1 pt. 4,858

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,864
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 94 pts. 10,845
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 88 pts. 10,837
  4. Avatar for LociOiling 4. LociOiling Lv 1 82 pts. 10,820
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 76 pts. 10,793
  6. Avatar for SemperRabbit 6. SemperRabbit Lv 1 71 pts. 10,782
  7. Avatar for grogar7 7. grogar7 Lv 1 66 pts. 10,765
  8. Avatar for bravosk8erboy 8. bravosk8erboy Lv 1 61 pts. 10,729
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 56 pts. 10,686
  10. Avatar for gmn 10. gmn Lv 1 52 pts. 10,682

Comments