Icon representing a puzzle

2710: Revisiting Puzzle 68: Bos Taurus

Closed since 3 months ago

Novice Overall Prediction

Summary


Created
January 07, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 9,823
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 7,317
  3. Avatar for BearCorp 13. BearCorp 1 pt. 4,858

  1. Avatar for NinjaGreg 21. NinjaGreg Lv 1 21 pts. 10,573
  2. Avatar for drjr 22. drjr Lv 1 19 pts. 10,569
  3. Avatar for Elfi 23. Elfi Lv 1 17 pts. 10,538
  4. Avatar for zxspectrum 24. zxspectrum Lv 1 16 pts. 10,517
  5. Avatar for g_b 25. g_b Lv 1 14 pts. 10,504
  6. Avatar for dpmattingly 26. dpmattingly Lv 1 13 pts. 10,504
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 12 pts. 10,498
  8. Avatar for majyunyan 28. majyunyan Lv 1 10 pts. 10,486
  9. Avatar for aendgraend 29. aendgraend Lv 1 9 pts. 10,457
  10. Avatar for heather-1 30. heather-1 Lv 1 8 pts. 10,421

Comments